PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_15899
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MYB
Protein Properties Length: 233aa    MW: 27795.4 Da    PI: 7.6099
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_15899genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed ll + vk++G g+W+ ++r  g+ R++k+c++rw +yl
       PEQU_15899 16 KGPWTPQEDNLLTEHVKLHGEGRWNCVSRLTGLMRSGKSCRLRWVNYL 63
                     79********************************************97 PP

2Myb_DNA-binding50.45.2e-1669113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+ E  +++++++++G++ W+tIar ++ gRt++++k++w+++
       PEQU_15899  69 RGKITPHEVTIILELHAKWGNR-WSTIARSLP-GRTDNEIKNYWRTH 113
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9531163IPR017930Myb domain
SuperFamilySSF466891.41E-2814110IPR009057Homeodomain-like
SMARTSM007171.6E-121565IPR001005SANT/Myb domain
PfamPF002491.1E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-211770IPR009057Homeodomain-like
CDDcd001671.95E-91863No hitNo description
PROSITE profilePS5129423.73164118IPR017930Myb domain
SMARTSM007173.7E-1568116IPR001005SANT/Myb domain
PfamPF002492.3E-1369113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2371116IPR009057Homeodomain-like
CDDcd001671.67E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEGHYGWGTS EDGWRKGPWT PQEDNLLTEH VKLHGEGRWN CVSRLTGLMR SGKSCRLRWV  60
NYLRPDLKRG KITPHEVTII LELHAKWGNR WSTIARSLPG RTDNEIKNYW RTHFKKGRST  120
KNIEKARAKF LKQQHEQKQL QQQLLQQQQQ QQLRLEVPQF EERAVAQEMQ EMAYMCNMPY  180
VFHGEEIVDK MTVSRCDDRS SDDEAYFDMW ENQQWSLDDL GLDMGDQMLP FYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-241611627126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX0338853e-67JX033885.1 Dendrobium nobile microsatellite DNeSSR175 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010918950.17e-89PREDICTED: myb-related protein 340
TrEMBLK9LYW72e-80K9LYW7_9ASPA; R2R3 MYB
STRINGSb04g026210.12e-77(Sorghum bicolor)
STRINGGSMUA_Achr8P12710_0017e-78(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.13e-64myb domain protein 305